PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P18670_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 290aa    MW: 33818.5 Da    PI: 4.5441
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P18670_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.33.6e-2089144156
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rr+R++f++eq++ +e++Fe + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  GSMUA_Achr1P18670_001  89 RRTRRRFSEEQIKSMESMFETQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWK 144
                            89*****************************************************9 PP

2HD-ZIP_I/II117.95.7e-3891182293
            HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                             +rr+s+eq+k++E++Fe+++kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE++y+ Lk+ ydal ++ ++L+ke++ L +
  GSMUA_Achr1P18670_001  91 TRRRFSEEQIKSMESMFETQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLEREYRGLKADYDALLSSFDSLKKEKQLLLQ 178
                            589************************************************************************************9 PP

            HD-ZIP_I/II  90 elke 93 
                            +l++
  GSMUA_Achr1P18670_001 179 QLQD 182
                            9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-1965147IPR009057Homeodomain-like
SuperFamilySSF466891.06E-2074148IPR009057Homeodomain-like
PROSITE profilePS5007118.99886146IPR001356Homeobox domain
SMARTSM003894.3E-1888150IPR001356Homeobox domain
PfamPF000461.7E-1789144IPR001356Homeobox domain
CDDcd000862.14E-1495147No hitNo description
PRINTSPR000311.1E-5117126IPR000047Helix-turn-helix motif
PROSITE patternPS000270121144IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5126142IPR000047Helix-turn-helix motif
PfamPF021835.0E-14146186IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MNLETRVWER NSSSPSFLQE HLSAADIEQH IHPPTSSPCC CCWWWWWLTE GSACEMMESE  60
EEQSAAEEGD CCSWMNPTAE SSKGKGDRRR TRRRFSEEQI KSMESMFETQ TKLEPRQKLQ  120
LARELGLQPR QVAIWFQNKR ARWKSKQLER EYRGLKADYD ALLSSFDSLK KEKQLLLQQL  180
QDLAELIDKA EERSNRDDEG SNDRDSEIKK DQSSRLSLKE EADLEFAVCA AEEDKKPRYF  240
SEDELNLCAG QPAISSLTSS AEQQFCLTTS WPSDQSCNNS QWWEFWPLSE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0361738e-56BT036173.1 Zea mays full-length cDNA clone ZM_BFb0099K03 mRNA, complete cds.
GenBankBT0411148e-56BT041114.1 Zea mays full-length cDNA clone ZM_BFc0176L16 mRNA, complete cds.
GenBankEU9635508e-56EU963550.1 Zea mays clone 263983 homeodomain-leucine zipper transcription factor TaHDZipI-1 mRNA, complete cds.
GenBankKJ7276088e-56KJ727608.1 Zea mays clone pUT5468 HB transcription factor (HB126) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009412772.11e-167PREDICTED: homeobox-leucine zipper protein HOX6-like
SwissprotQ651Z53e-53HOX6_ORYSJ; Homeobox-leucine zipper protein HOX6
SwissprotQ9XH353e-53HOX6_ORYSI; Homeobox-leucine zipper protein HOX6
TrEMBLM0S1250.0M0S125_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P18670_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78733448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.13e-35homeobox 7